Lineage for d4nn3a_ (4nn3 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624948Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1624949Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1626115Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1626116Protein automated matches [190039] (87 species)
    not a true protein
  7. 1626272Species Desulfovibrio salexigens [TaxId:526222] [256368] (2 PDB entries)
  8. 1626274Domain d4nn3a_: 4nn3 A: [253985]
    automated match to d2ceya_
    complexed with cl, oro, pge

Details for d4nn3a_

PDB Entry: 4nn3 (more details), 1.4 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from desulfovibrio salexigens (desal_2161), target efi-510109, with bound orotic acid
PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4nn3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nn3a_ c.94.1.0 (A:) automated matches {Desulfovibrio salexigens [TaxId: 526222]}
kyearighlesplqprhqglekvaklvkertngevefkifpssqlgnqrqmnegvqfgti
egtvsaaaflggfnpvvsimdipfllpvdrakaqelrqgkfgkallksfdsrgfkaiatw
pngrknftsnkpistiadykgqsfrvmdskilieqfaaigasaialpfgelytalqngvv
dgeenpldtiqrmkfyevqkylvtsehgamedyvlfnpsyweslpenyqkiivdtfievm
pgveahkeqaqkdalevikkagvqvtplqaadraamrelmypktkaaylaragaqgqeli
klyeeeyariv

SCOPe Domain Coordinates for d4nn3a_:

Click to download the PDB-style file with coordinates for d4nn3a_.
(The format of our PDB-style files is described here.)

Timeline for d4nn3a_: