SCOPe 2.04: Domain d4nn3a_: 4nn3 A:

Lineage for d4nn3a_ (4nn3 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (87 species)
   not a true protein

7. Species Desulfovibrio salexigens [TaxId:526222] [256368] (2 PDB entries)

8. Domain d4nn3a_: 4nn3 A: [253985]
   automated match to d2ceya_
   complexed with cl, oro, pge

Details for d4nn3a_

PDB Entry: 4nn3, 1.4 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from desulfovibrio salexigens (desal_2161), target efi-510109, with bound orotic acid

PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4nn3a_:

Sequence; same for both SEQRES and ATOM records:

>d4nn3a_ c.94.1.0 (A:) automated matches {Desulfovibrio salexigens [TaxId: 526222]}
kyearighlesplqprhqglekvaklvkertngevefkifpssqlgnqrqmnegvqfgti
egtvsaaaflggfnpvvsimdipfllpvdrakaqelrqgkfgkallksfdsrgfkaiatw
pngrknftsnkpistiadykgqsfrvmdskilieqfaaigasaialpfgelytalqngvv
dgeenpldtiqrmkfyevqkylvtsehgamedyvlfnpsyweslpenyqkiivdtfievm
pgveahkeqaqkdalevikkagvqvtplqaadraamrelmypktkaaylaragaqgqeli
klyeeeyariv

Timeline for d4nn3a_:

• d4nn3a_ is new in SCOPe 2.04-stable
  
• d4nn3a_ appears in SCOPe 2.05
  
• d4nn3a_ appears in the current release, SCOPe 2.08