SCOPe 2.07: Domain d4nm2a1: 4nm2 A:12-91

Lineage for d4nm2a1 (4nm2 A:12-91)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
   topologically similar to the second domain

7. Species Human (Homo sapiens) [TaxId:9606] [47805] (145 PDB entries)
   Uniprot P06746

8. Domain d4nm2a1: 4nm2 A:12-91 [253982]
   Other proteins in same PDB: d4nm2a2, d4nm2a3
   automated match to d1tv9a1
   protein/DNA complex; complexed with na

Details for d4nm2a1

PDB Entry: 4nm2, 2.52 Å

PDB Description: Structure of human DNA polymerase beta complexed with a nicked DNA containing a 8BrG-G at N-1 position and G-C at N position

PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d4nm2a1:

Sequence; same for both SEQRES and ATOM records:

>d4nm2a1 a.60.6.1 (A:12-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
nggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtkiae
kideflatgklrklekirqd

Timeline for d4nm2a1:

• d4nm2a1 first appeared in SCOPe 2.04
  
• d4nm2a1 appears in SCOPe 2.06
  
• d4nm2a1 appears in the current release, SCOPe 2.08