Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) |
Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins) barrel, closed; n=5, S=8 |
Protein Inorganic pyrophosphatase [50326] (9 species) eukaryotic enzyme has additional secondary structures at both N- and C-termini |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50327] (19 PDB entries) |
Domain d1wgjb_: 1wgj B: [25398] complexed with mn, po4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1wgj (more details), 2 Å
SCOPe Domain Sequences for d1wgjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgjb_ b.40.5.1 (B:) Inorganic pyrophosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi dltnvtlpdtptyskaasdaippaslkadapidksidkwffi
Timeline for d1wgjb_: