Lineage for d4nhff_ (4nhf F:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896937Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1896938Protein automated matches [190205] (21 species)
    not a true protein
  7. 1896944Species Bartonella grahamii [TaxId:634504] [256352] (2 PDB entries)
  8. 1896950Domain d4nhff_: 4nhf F: [253958]
    automated match to d2bhma1
    complexed with ca

Details for d4nhff_

PDB Entry: 4nhf (more details), 2 Å

PDB Description: crystal structure of the soluble domain of trwg type iv secretion machinery from bartonella grahamii
PDB Compounds: (F:) TrwG protein

SCOPe Domain Sequences for d4nhff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nhff_ d.17.4.0 (F:) automated matches {Bartonella grahamii [TaxId: 634504]}
etsygevvdrywlnqyvlnrenydydtiqlnydttallsaasvqqeyykiydgenardkv
lsnkaritvkvrsiqlnglgqatvrfttqqldssgattgpkqhqiatigytyvgapmkss
drllnplgfqitsyrsdpeilln

SCOPe Domain Coordinates for d4nhff_:

Click to download the PDB-style file with coordinates for d4nhff_.
(The format of our PDB-style files is described here.)

Timeline for d4nhff_: