![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
![]() | Protein automated matches [190205] (35 species) not a true protein |
![]() | Species Bartonella grahamii [TaxId:634504] [256352] (2 PDB entries) |
![]() | Domain d4nhfc_: 4nhf C: [253955] automated match to d2bhma1 complexed with ca |
PDB Entry: 4nhf (more details), 2 Å
SCOPe Domain Sequences for d4nhfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nhfc_ d.17.4.0 (C:) automated matches {Bartonella grahamii [TaxId: 634504]} etsygevvdrywlnqyvlnrenydydtiqlnydttallsaasvqqeyykiydgenardkv lsnkaritvkvrsiqlnglgqatvrfttqqldssgattgpkqhqiatigytyvgapmkss drllnplgfqitsyrsdpeill
Timeline for d4nhfc_: