SCOPe 2.04: Domain d4nhfb_: 4nhf B:

Lineage for d4nhfb_ (4nhf B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (19 species)
   not a true protein

7. Species Bartonella grahamii [TaxId:634504] [256352] (2 PDB entries)

8. Domain d4nhfb_: 4nhf B: [253954]
   automated match to d2bhma1
   complexed with ca

Details for d4nhfb_

PDB Entry: 4nhf, 2 Å

PDB Description: crystal structure of the soluble domain of trwg type iv secretion machinery from bartonella grahamii

PDB Compounds: (B:) TrwG protein

SCOPe Domain Sequences for d4nhfb_:

Sequence, based on SEQRES records:

>d4nhfb_ d.17.4.0 (B:) automated matches {Bartonella grahamii [TaxId: 634504]}
sygevvdrywlnqyvlnrenydydtiqlnydttallsaasvqqeyykiydgenardkvls
nkaritvkvrsiqlnglgqatvrfttqqldssgattgpkqhqiatigytyvgapmkssdr
llnplgfqitsyrsdpeilln

Sequence, based on observed residues (ATOM records):

>d4nhfb_ d.17.4.0 (B:) automated matches {Bartonella grahamii [TaxId: 634504]}
sygevvdrywlnqyvlnrenydydtiqlnydttallsaasvqqeyykiydgenardkvls
nkaritvkvrsiqlnglgqatvrfttqqldsttgpkqhqiatigytyvgapmkssdrlln
plgfqitsyrsdpeilln

Timeline for d4nhfb_:

• d4nhfb_ is new in SCOPe 2.04-stable
  
• d4nhfb_ appears in SCOPe 2.05
  
• d4nhfb_ appears in the current release, SCOPe 2.08