SCOPe 2.04: Domain d4nf2c2: 4nf2 C:152-311

Lineage for d4nf2c2 (4nf2 C:152-311)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (22 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:261594] [256371] (1 PDB entry)

8. Domain d4nf2c2: 4nf2 C:152-311 [253947]
   automated match to d4h31c2
   complexed with cl, cp, nva

Details for d4nf2c2

PDB Entry: 4nf2, 1.74 Å

PDB Description: crystal structure of anabolic ornithine carbamoyltransferase from bacillus anthracis in complex with carbamoyl phosphate and l- norvaline

PDB Compounds: (C:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d4nf2c2:

Sequence; same for both SEQRES and ATOM records:

>d4nf2c2 c.78.1.0 (C:152-311) automated matches {Bacillus anthracis [TaxId: 261594]}
tfkgiklayvgdgnnvchslllasakvgmhmtvatpvgyrpneeivkkalaiaketgaei
eilhnpelavneadfiytdvwmsmgqegeeekytlfqpyqinkelvkhakqtyhflhclp
ahreeevtgeiidgpqsivfeqagnrlhaqkallvslfkn

Timeline for d4nf2c2:

• d4nf2c2 is new in SCOPe 2.04-stable
  
• d4nf2c2 appears in SCOPe 2.05
  
• d4nf2c2 appears in the current release, SCOPe 2.08