Lineage for d4nf2c1 (4nf2 C:5-151)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2906891Species Bacillus anthracis [TaxId:261594] [256371] (1 PDB entry)
  8. 2906896Domain d4nf2c1: 4nf2 C:5-151 [253946]
    automated match to d3upda1
    complexed with cl, cp, nva

Details for d4nf2c1

PDB Entry: 4nf2 (more details), 1.74 Å

PDB Description: crystal structure of anabolic ornithine carbamoyltransferase from bacillus anthracis in complex with carbamoyl phosphate and l- norvaline
PDB Compounds: (C:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d4nf2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nf2c1 c.78.1.0 (C:5-151) automated matches {Bacillus anthracis [TaxId: 261594]}
qvpklntkdlltleeltqeeiisliefaiylkknkqepllqgkilglifdkhstrtrvsf
eagmvqlgghgmflngkemqmqrgetvsdtakvlshyidgimirtfshadveelakessi
pvingltddhhpcqaladlmtiyeetn

SCOPe Domain Coordinates for d4nf2c1:

Click to download the PDB-style file with coordinates for d4nf2c1.
(The format of our PDB-style files is described here.)

Timeline for d4nf2c1: