Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
Protein automated matches [226938] (22 species) not a true protein |
Species Bacillus anthracis [TaxId:261594] [256371] (1 PDB entry) |
Domain d4nf2b1: 4nf2 B:5-151 [253944] automated match to d3upda1 complexed with cl, cp, nva |
PDB Entry: 4nf2 (more details), 1.74 Å
SCOPe Domain Sequences for d4nf2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nf2b1 c.78.1.0 (B:5-151) automated matches {Bacillus anthracis [TaxId: 261594]} qvpklntkdlltleeltqeeiisliefaiylkknkqepllqgkilglifdkhstrtrvsf eagmvqlgghgmflngkemqmqrgetvsdtakvlshyidgimirtfshadveelakessi pvingltddhhpcqaladlmtiyeetn
Timeline for d4nf2b1:
View in 3D Domains from other chains: (mouse over for more information) d4nf2a1, d4nf2a2, d4nf2c1, d4nf2c2 |