SCOPe 2.05: Domain d4nf2a1: 4nf2 A:5-151

Lineage for d4nf2a1 (4nf2 A:5-151)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (22 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:261594] [256371] (1 PDB entry)

8. Domain d4nf2a1: 4nf2 A:5-151 [253942]
   automated match to d3upda1
   complexed with cl, cp, nva

Details for d4nf2a1

PDB Entry: 4nf2, 1.74 Å

PDB Description: crystal structure of anabolic ornithine carbamoyltransferase from bacillus anthracis in complex with carbamoyl phosphate and l- norvaline

PDB Compounds: (A:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d4nf2a1:

Sequence; same for both SEQRES and ATOM records:

>d4nf2a1 c.78.1.0 (A:5-151) automated matches {Bacillus anthracis [TaxId: 261594]}
qvpklntkdlltleeltqeeiisliefaiylkknkqepllqgkilglifdkhstrtrvsf
eagmvqlgghgmflngkemqmqrgetvsdtakvlshyidgimirtfshadveelakessi
pvingltddhhpcqaladlmtiyeetn

Timeline for d4nf2a1:

• d4nf2a1 first appeared in SCOPe 2.04
  
• d4nf2a1 appears in SCOPe 2.06
  
• d4nf2a1 appears in the current release, SCOPe 2.08