Lineage for d4nera2 (4ner A:171-335)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367152Family b.6.1.3: Multidomain cupredoxins [49550] (8 protein domains)
  6. 2367277Protein multi-copper oxidase CueO [69194] (1 species)
  7. 2367278Species Escherichia coli [TaxId:562] [69195] (34 PDB entries)
  8. 2367331Domain d4nera2: 4ner A:171-335 [253940]
    Other proteins in same PDB: d4nera4
    automated match to d3od3a2
    complexed with cu, o, oh

Details for d4nera2

PDB Entry: 4ner (more details), 1.6 Å

PDB Description: Multicopper Oxidase CueO (data1)
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d4nera2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nera2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
mlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavgwfgdtlltngaiypqhaaprgw
lrlrllngcnarslnfatsdnrplyviasdggllpepvkvselpvlmgerfevlvevndn
kpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasgalpdtls

SCOPe Domain Coordinates for d4nera2:

Click to download the PDB-style file with coordinates for d4nera2.
(The format of our PDB-style files is described here.)

Timeline for d4nera2: