Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein multi-copper oxidase CueO, N- and middle domain [418908] (1 species) |
Species Escherichia coli [TaxId:562] [419322] (38 PDB entries) |
Domain d4nera1: 4ner A:29-170 [253939] Other proteins in same PDB: d4nera3, d4nera4 automated match to d1kv7a1 complexed with cu, o, oh |
PDB Entry: 4ner (more details), 1.6 Å
SCOPe Domain Sequences for d4nera1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nera1 b.6.1.3 (A:29-170) multi-copper oxidase CueO, N- and middle domain {Escherichia coli [TaxId: 562]} aerptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtv diynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgkt grqvamglaglvvieddeilkl
Timeline for d4nera1: