Lineage for d4ndmb2 (4ndm B:122-212)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (808 PDB entries)
  8. 2353682Domain d4ndmb2: 4ndm B:122-212 [253938]
    Other proteins in same PDB: d4ndma1, d4ndma3, d4ndmb1
    automated match to d2f54d2

Details for d4ndmb2

PDB Entry: 4ndm (more details), 3.01 Å

PDB Description: structure of the ab18.1 tcr
PDB Compounds: (B:) human nkt tcr alpha chain

SCOPe Domain Sequences for d4ndmb2:

Sequence, based on SEQRES records: (download)

>d4ndmb2 b.1.1.2 (B:122-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpspe

Sequence, based on observed residues (ATOM records): (download)

>d4ndmb2 b.1.1.2 (B:122-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
snksdfacanafnnsiipedtffpspe

SCOPe Domain Coordinates for d4ndmb2:

Click to download the PDB-style file with coordinates for d4ndmb2.
(The format of our PDB-style files is described here.)

Timeline for d4ndmb2: