Lineage for d4ndmb2 (4ndm B:122-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749668Protein T-cell antigen receptor [49125] (7 species)
  7. 2749711Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries)
  8. 2749762Domain d4ndmb2: 4ndm B:122-212 [253938]
    Other proteins in same PDB: d4ndma1, d4ndma2, d4ndma3, d4ndmb1
    automated match to d2f54d2

Details for d4ndmb2

PDB Entry: 4ndm (more details), 3.01 Å

PDB Description: structure of the ab18.1 tcr
PDB Compounds: (B:) human nkt tcr alpha chain

SCOPe Domain Sequences for d4ndmb2:

Sequence, based on SEQRES records: (download)

>d4ndmb2 b.1.1.2 (B:122-212) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpspe

Sequence, based on observed residues (ATOM records): (download)

>d4ndmb2 b.1.1.2 (B:122-212) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
iqnpdpavyqlrdsksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
snksdfacanafnnsiipedtffpspe

SCOPe Domain Coordinates for d4ndmb2:

Click to download the PDB-style file with coordinates for d4ndmb2.
(The format of our PDB-style files is described here.)

Timeline for d4ndmb2: