SCOPe 2.08: Domain d4ndma1: 4ndm A:9-118

Lineage for d4ndma1 (4ndm A:9-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4ndma1: 4ndm A:9-118 [253935]
   Other proteins in same PDB: d4ndma2, d4ndma3, d4ndmb2
   automated match to d3axlb1

Details for d4ndma1

PDB Entry: 4ndm, 3.01 Å

PDB Description: structure of the ab18.1 tcr

PDB Compounds: (A:) T-cell gamma protein,T-cell receptor beta-2 chain C region

SCOPe Domain Sequences for d4ndma1:

Sequence; same for both SEQRES and ATOM records:

>d4ndma1 b.1.1.0 (A:9-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tksvtrptrssaeitcdltvinafyihwylhqegkapqrllyydvsnskdvlesglspgk
yythtprrwswililrnliendsgvyycatwdrnnkklfgsgttlvvted

Timeline for d4ndma1:

• d4ndma1 first appeared in SCOPe 2.04
  
• d4ndma1 appears in SCOPe 2.07