Lineage for d4ndma1 (4ndm A:9-118)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2357444Domain d4ndma1: 4ndm A:9-118 [253935]
    Other proteins in same PDB: d4ndma2, d4ndma3, d4ndmb2
    automated match to d3axlb1

Details for d4ndma1

PDB Entry: 4ndm (more details), 3.01 Å

PDB Description: structure of the ab18.1 tcr
PDB Compounds: (A:) T-cell gamma protein,T-cell receptor beta-2 chain C region

SCOPe Domain Sequences for d4ndma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ndma1 b.1.1.0 (A:9-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tksvtrptrssaeitcdltvinafyihwylhqegkapqrllyydvsnskdvlesglspgk
yythtprrwswililrnliendsgvyycatwdrnnkklfgsgttlvvted

SCOPe Domain Coordinates for d4ndma1:

Click to download the PDB-style file with coordinates for d4ndma1.
(The format of our PDB-style files is described here.)

Timeline for d4ndma1: