| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
| Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
| Protein automated matches [190459] (61 species) not a true protein |
| Species Staphylococcus aureus [TaxId:196620] [237670] (3 PDB entries) |
| Domain d4nahd_: 4nah D: [253928] automated match to d4naua_ complexed with 2vj, ags |
PDB Entry: 4nah (more details), 2.38 Å
SCOPe Domain Sequences for d4nahd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nahd_ c.26.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 196620]}
ehtiavipgsfdpityghldiierstdrfdeihvcvlknskkegtfsleermdlieqsvk
hlpnvkvhqfsgllvdyceqvgaktiirglravsdfeyelrltsmnkklnneietlymms
stnysfisssivkevaayradisefvppyvekalkkkfk
Timeline for d4nahd_: