Lineage for d4nahd_ (4nah D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2861125Species Staphylococcus aureus [TaxId:196620] [237670] (3 PDB entries)
  8. 2861132Domain d4nahd_: 4nah D: [253928]
    automated match to d4naua_
    complexed with 2vj, ags

Details for d4nahd_

PDB Entry: 4nah (more details), 2.38 Å

PDB Description: Inhibitors of 4-Phosphopanthetheine Adenylyltransferase (PPAT)
PDB Compounds: (D:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d4nahd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nahd_ c.26.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 196620]}
ehtiavipgsfdpityghldiierstdrfdeihvcvlknskkegtfsleermdlieqsvk
hlpnvkvhqfsgllvdyceqvgaktiirglravsdfeyelrltsmnkklnneietlymms
stnysfisssivkevaayradisefvppyvekalkkkfk

SCOPe Domain Coordinates for d4nahd_:

Click to download the PDB-style file with coordinates for d4nahd_.
(The format of our PDB-style files is described here.)

Timeline for d4nahd_: