Lineage for d1pfsb_ (1pfs B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2060311Family b.40.4.7: Phage ssDNA-binding proteins [50315] (4 proteins)
    barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms
  6. 2060317Protein Gene V protein [50316] (2 species)
  7. 2060341Species Pseudomonas phage Pf3 [TaxId:10872] [50318] (1 PDB entry)
  8. 2060343Domain d1pfsb_: 1pfs B: [25392]

Details for d1pfsb_

PDB Entry: 1pfs (more details)

PDB Description: solution nmr structure of the single-stranded dna binding protein of the filamentous pseudomonas phage pf3, minimized average structure
PDB Compounds: (B:) pf3 single-stranded DNA binding protein

SCOPe Domain Sequences for d1pfsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfsb_ b.40.4.7 (B:) Gene V protein {Pseudomonas phage Pf3 [TaxId: 10872]}
mniqitftdsvrqgtsakgnpytfqegflhledkphplqcqffvesvipagsyqvpyrin
vnngrpelafdfkamkra

SCOPe Domain Coordinates for d1pfsb_:

Click to download the PDB-style file with coordinates for d1pfsb_.
(The format of our PDB-style files is described here.)

Timeline for d1pfsb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pfsa_