SCOPe 2.08: Domain d4n6ka1: 4n6k A:29-333

Lineage for d4n6ka1 (4n6k A:29-333)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Desulfovibrio salexigens [TaxId:526222] [256368] (3 PDB entries)

8. Domain d4n6ka1: 4n6k A:29-333 [253913]
   Other proteins in same PDB: d4n6ka2
   automated match to d2ceya_
   complexed with x3x

Details for d4n6ka1

PDB Entry: 4n6k, 1.2 Å

PDB Description: Crystal structure of a TRAP periplasmic solute binding protein from Desulfovibrio salexigens DSM2638, Target EFI-510113 (Desal_0342), complex with diglycerolphosphate

PDB Compounds: (A:) TRAP dicarboxylate transporter-DctP subunit

SCOPe Domain Sequences for d4n6ka1:

Sequence; same for both SEQRES and ATOM records:

>d4n6ka1 c.94.1.0 (A:29-333) automated matches {Desulfovibrio salexigens [TaxId: 526222]}
ykltlklshvfspaeqlsksmdavaesiyektdgainiqtfpqaqlpaykegveqvvrga
kfisvedpsfigdyvpdfkalyapmlyrsfdeyvnltqsdlvkkmqaeaekqgikilald
yiygfrnlitqkviktpadlkgmkirtpgsksyidtltamgavatplpwgetlsavqqgv
vdglegseftnigtkvyegptknvantrhilgtcgvyistkvwndipakyqkiiqdeftn
ganhmvnllksqhggvvkelesygvkfnevdgdafraalkplykeqkgmtpgiyqsifke
ldamr

Timeline for d4n6ka1:

• d4n6ka1 first appeared in SCOPe 2.04, called d4n6ka_
  
• d4n6ka1 appears in SCOPe 2.07