![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
![]() | Protein automated matches [190276] (12 species) not a true protein |
![]() | Species Nitrosomonas europaea [TaxId:915] [256367] (4 PDB entries) |
![]() | Domain d4n4oc_: 4n4o C: [253879] automated match to d1fgja_ complexed with 12p, hec, hem, hoa, k, po4 |
PDB Entry: 4n4o (more details), 2.47 Å
SCOPe Domain Sequences for d4n4oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n4oc_ a.138.1.3 (C:) automated matches {Nitrosomonas europaea [TaxId: 915]} distvpdetydalkldrgkatpketyealvkrykdpahgagkgtmgdywepiaisiymdp ntfykppvspkevaerkdcvechsdetpvwvrawkrsthanldkirnlksddplyykkgk leevennlrsmgklgeketlkevgcidchvdvnkkdkadhtkdirmptadtcgtchlref aereserdtmvwpngqwpagrpshaldytaniettvwaampqrevaegctmchtnqnkcd nchtrhefsaaesrkpeacatchsgvdhnnweaytmskhgklaemnrdkwnwevrlkdaf skggqnaptcaachmeyegeythnitrktrwanypfvpgiaenitsdwsearldswvltc tqchserfarsyldlmdkgtleglakyqeanaivhkmyedgtltgqktnrpnppepekpg fgiftqlfwskgnnpaslelkvlemaennlakmhvglahvnpggwtytegwgpmnrayve iqdeytkmqelsalqarvnkle
Timeline for d4n4oc_: