Lineage for d4n23c1 (4n23 C:236-351)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3042053Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 3042189Family h.3.2.0: automated matches [254265] (1 protein)
    not a true family
  6. 3042190Protein automated matches [254613] (3 species)
    not a true protein
  7. 3042191Species Cas virus [TaxId:1223561] [256366] (2 PDB entries)
  8. 3042200Domain d4n23c1: 4n23 C:236-351 [253874]
    Other proteins in same PDB: d4n23a2, d4n23b2, d4n23c2
    automated match to d1ebof_
    complexed with mpd, mrd

Details for d4n23c1

PDB Entry: 4n23 (more details), 2 Å

PDB Description: Crystal structure of the GP2 Core Domain from the California Academy of Science Virus, monoclinic symmetry
PDB Compounds: (C:) GP2 Ectodomain

SCOPe Domain Sequences for d4n23c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n23c1 h.3.2.0 (C:236-351) automated matches {Cas virus [TaxId: 1223561]}
nmkqiedkieeilskiyhieneiarikkligaiaskiiktanyttnalfllnkeeseird
hvvehelalnyllahqgglcnvvkgpmcssdiddfsknvsdmidkvheemkkfyhe

SCOPe Domain Coordinates for d4n23c1:

Click to download the PDB-style file with coordinates for d4n23c1.
(The format of our PDB-style files is described here.)

Timeline for d4n23c1: