SCOPe 2.07: Domain d4n23a1: 4n23 A:236-351

Lineage for d4n23a1 (4n23 A:236-351)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (2 families)

5. Family h.3.2.0: automated matches [254265] (1 protein)
   not a true family

6. Protein automated matches [254613] (3 species)
   not a true protein

7. Species Cas virus [TaxId:1223561] [256366] (2 PDB entries)

8. Domain d4n23a1: 4n23 A:236-351 [253872]
   Other proteins in same PDB: d4n23a2, d4n23b2, d4n23c2
   automated match to d1ebof_
   complexed with mpd, mrd

Details for d4n23a1

PDB Entry: 4n23, 2 Å

PDB Description: Crystal structure of the GP2 Core Domain from the California Academy of Science Virus, monoclinic symmetry

PDB Compounds: (A:) GP2 Ectodomain

SCOPe Domain Sequences for d4n23a1:

Sequence; same for both SEQRES and ATOM records:

>d4n23a1 h.3.2.0 (A:236-351) automated matches {Cas virus [TaxId: 1223561]}
nmkqiedkieeilskiyhieneiarikkligaiaskiiktanyttnalfllnkeeseird
hvvehelalnyllahqgglcnvvkgpmcssdiddfsknvsdmidkvheemkkfyhe

Timeline for d4n23a1:

• d4n23a1 first appeared in SCOPe 2.04, called d4n23a_
  
• d4n23a1 appears in SCOPe 2.06
  
• d4n23a1 appears in the current release, SCOPe 2.08