| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.2: Virus ectodomain [58069] (2 families) ![]() |
| Family h.3.2.0: automated matches [254265] (1 protein) not a true family |
| Protein automated matches [254613] (3 species) not a true protein |
| Species Cas virus [TaxId:1223561] [256366] (2 PDB entries) |
| Domain d4n23a_: 4n23 A: [253872] automated match to d1ebof_ complexed with mpd, mrd |
PDB Entry: 4n23 (more details), 2 Å
SCOPe Domain Sequences for d4n23a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n23a_ h.3.2.0 (A:) automated matches {Cas virus [TaxId: 1223561]}
enlyfqgnmkqiedkieeilskiyhieneiarikkligaiaskiiktanyttnalfllnk
eeseirdhvvehelalnyllahqgglcnvvkgpmcssdiddfsknvsdmidkvheemkkf
yhe
Timeline for d4n23a_: