![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.2: Virus ectodomain [58069] (2 families) ![]() |
![]() | Family h.3.2.0: automated matches [254265] (1 protein) not a true family |
![]() | Protein automated matches [254613] (3 species) not a true protein |
![]() | Species Cas virus [TaxId:1223561] [256366] (2 PDB entries) |
![]() | Domain d4n23a1: 4n23 A:236-351 [253872] Other proteins in same PDB: d4n23a2, d4n23b2, d4n23c2 automated match to d1ebof_ complexed with mpd, mrd |
PDB Entry: 4n23 (more details), 2 Å
SCOPe Domain Sequences for d4n23a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n23a1 h.3.2.0 (A:236-351) automated matches {Cas virus [TaxId: 1223561]} nmkqiedkieeilskiyhieneiarikkligaiaskiiktanyttnalfllnkeeseird hvvehelalnyllahqgglcnvvkgpmcssdiddfsknvsdmidkvheemkkfyhe
Timeline for d4n23a1:
![]() Domains from other chains: (mouse over for more information) d4n23b1, d4n23b2, d4n23c1, d4n23c2 |