![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.2: Virus ectodomain [58069] (2 families) ![]() |
![]() | Family h.3.2.0: automated matches [254265] (1 protein) not a true family |
![]() | Protein automated matches [254613] (3 species) not a true protein |
![]() | Species Cas virus [TaxId:1223561] [256366] (2 PDB entries) |
![]() | Domain d4n21f_: 4n21 F: [253871] automated match to d1ebof_ complexed with mpd |
PDB Entry: 4n21 (more details), 1.99 Å
SCOPe Domain Sequences for d4n21f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n21f_ h.3.2.0 (F:) automated matches {Cas virus [TaxId: 1223561]} henlyfqgnmkqiedkieeilskiyhieneiarikkligaiaskiiktanyttnalflln keeseirdhvvehelalnyllahqgglcnvvkgpmcssdiddfsknvsdmidkvheemkk fyhe
Timeline for d4n21f_: