Lineage for d4n21e_ (4n21 E:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1970302Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 1970426Family h.3.2.0: automated matches [254265] (1 protein)
    not a true family
  6. 1970427Protein automated matches [254613] (3 species)
    not a true protein
  7. 1970428Species Cas virus [TaxId:1223561] [256366] (2 PDB entries)
  8. 1970433Domain d4n21e_: 4n21 E: [253870]
    automated match to d1ebof_
    complexed with mpd

Details for d4n21e_

PDB Entry: 4n21 (more details), 1.99 Å

PDB Description: Crystal structure of the GP2 Core Domain from the California Academy of Science Virus
PDB Compounds: (E:) GP2 Ectodomain

SCOPe Domain Sequences for d4n21e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n21e_ h.3.2.0 (E:) automated matches {Cas virus [TaxId: 1223561]}
nlyfqgnmkqiedkieeilskiyhieneiarikkligaiaskiiktanyttnalfllnke
eseirdhvvehelalnyllahqgglcnvvkgpmcssdiddfsknvsdmidkvheemkkfy
h

SCOPe Domain Coordinates for d4n21e_:

Click to download the PDB-style file with coordinates for d4n21e_.
(The format of our PDB-style files is described here.)

Timeline for d4n21e_: