![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.2: Virus ectodomain [58069] (2 families) ![]() |
![]() | Family h.3.2.0: automated matches [254265] (1 protein) not a true family |
![]() | Protein automated matches [254613] (3 species) not a true protein |
![]() | Species Cas virus [TaxId:1223561] [256366] (2 PDB entries) |
![]() | Domain d4n21e1: 4n21 E:236-350 [253870] Other proteins in same PDB: d4n21a2, d4n21b2, d4n21c2, d4n21d2, d4n21e2, d4n21f2 automated match to d1ebof_ complexed with mpd |
PDB Entry: 4n21 (more details), 1.99 Å
SCOPe Domain Sequences for d4n21e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n21e1 h.3.2.0 (E:236-350) automated matches {Cas virus [TaxId: 1223561]} nmkqiedkieeilskiyhieneiarikkligaiaskiiktanyttnalfllnkeeseird hvvehelalnyllahqgglcnvvkgpmcssdiddfsknvsdmidkvheemkkfyh
Timeline for d4n21e1: