SCOPe 2.06: Domain d2gvba_: 2gvb A:

Lineage for d2gvba_ (2gvb A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.7: Phage ssDNA-binding proteins [50315] (4 proteins)
   barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms

6. Protein Gene V protein [50316] (2 species)

7. Species Enterobacteria phage M13, including coliphage f1 [TaxId:10870] [50317] (19 PDB entries)

8. Domain d2gvba_: 2gvb A: [25387]
   mutant

Details for d2gvba_

PDB Entry: 2gvb

PDB Description: refined solution structure of the tyr 41--> his mutant of the m13 gene v protein. a comparison with the crystal structure

PDB Compounds: (A:) gene v protein

SCOPe Domain Sequences for d2gvba_:

Sequence; same for both SEQRES and ATOM records:

>d2gvba_ b.40.4.7 (A:) Gene V protein {Enterobacteria phage M13, including coliphage f1 [TaxId: 10870]}
mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgnehpvlvkitldegqpayapgl
ytvhlssfkvgqfgslmidrlrlvpak

Timeline for d2gvba_:

• d2gvba_ first appeared (with stable ids) in SCOP 1.55
  
• d2gvba_ appears in SCOPe 2.05
  
• d2gvba_ appears in SCOPe 2.07
  
• d2gvba_ appears in the current release, SCOPe 2.08