Lineage for d2gvba_ (2gvb A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14248Family b.40.4.7: Filamentous bacteriophage ssDNA-binding proteins [50315] (2 proteins)
  6. 14252Protein Gene V protein [50316] (2 species)
  7. 14253Species Filamentous bacteriophage (f1, M13) [50317] (19 PDB entries)
  8. 14272Domain d2gvba_: 2gvb A: [25387]

Details for d2gvba_

PDB Entry: 2gvb (more details)

PDB Description: refined solution structure of the tyr 41--> his mutant of the m13 gene v protein. a comparison with the crystal structure

SCOP Domain Sequences for d2gvba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gvba_ b.40.4.7 (A:) Gene V protein {Filamentous bacteriophage (f1, M13)}
mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgnehpvlvkitldegqpayapgl
ytvhlssfkvgqfgslmidrlrlvpak

SCOP Domain Coordinates for d2gvba_:

Click to download the PDB-style file with coordinates for d2gvba_.
(The format of our PDB-style files is described here.)

Timeline for d2gvba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gvbb_