Lineage for d4n0fd1 (4n0f D:3-196)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343304Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2343305Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2343749Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2343750Protein automated matches [254493] (6 species)
    not a true protein
  7. 2343883Species Human (Homo sapiens) [TaxId:9606] [255068] (17 PDB entries)
  8. 2343942Domain d4n0fd1: 4n0f D:3-196 [253845]
    Other proteins in same PDB: d4n0fa1, d4n0fa2, d4n0fb_, d4n0fe1, d4n0fe2, d4n0ff_, d4n0fh1, d4n0fh2, d4n0fi_, d4n0fk1, d4n0fk2, d4n0fl_
    automated match to d3jrya1

Details for d4n0fd1

PDB Entry: 4n0f (more details), 3.02 Å

PDB Description: Human FcRn complexed with human serum albumin
PDB Compounds: (D:) serum albumin

SCOPe Domain Sequences for d4n0fd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n0fd1 a.126.1.0 (D:3-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
delrdegkassakq

SCOPe Domain Coordinates for d4n0fd1:

Click to download the PDB-style file with coordinates for d4n0fd1.
(The format of our PDB-style files is described here.)

Timeline for d4n0fd1: