Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein automated matches [191280] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189896] (33 PDB entries) |
Domain d4n0fa1: 4n0f A:4-176 [253842] Other proteins in same PDB: d4n0fa2, d4n0fb_, d4n0fd1, d4n0fd2, d4n0fd3, d4n0fe2, d4n0ff_, d4n0fg1, d4n0fg2, d4n0fg3, d4n0fh2, d4n0fi_, d4n0fj1, d4n0fj2, d4n0fj3, d4n0fk2, d4n0fl_, d4n0fm1, d4n0fm2, d4n0fm3 automated match to d1exua2 |
PDB Entry: 4n0f (more details), 3.02 Å
SCOPe Domain Sequences for d4n0fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n0fa1 d.19.1.1 (A:4-176) automated matches {Human (Homo sapiens) [TaxId: 9606]} hlsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswywek ettdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlk qgtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew
Timeline for d4n0fa1: