SCOPe 2.07: Domain d1yhaa_: 1yha A:

Lineage for d1yhaa_ (1yha A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.7: Phage ssDNA-binding proteins [50315] (4 proteins)
   barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms

6. Protein Gene V protein [50316] (2 species)

7. Species Enterobacteria phage M13, including coliphage f1 [TaxId:10870] [50317] (19 PDB entries)

8. Domain d1yhaa_: 1yha A: [25384]
   protein/DNA complex; mutant

Details for d1yhaa_

PDB Entry: 1yha, 2.5 Å

PDB Description: crystal structures of y41h and y41f mutants of gene v protein from ff phage suggest possible protein-protein interactions in gvp-ssdna complex

PDB Compounds: (A:) gene v protein

SCOPe Domain Sequences for d1yhaa_:

Sequence; same for both SEQRES and ATOM records:

>d1yhaa_ b.40.4.7 (A:) Gene V protein {Enterobacteria phage M13, including coliphage f1 [TaxId: 10870]}
mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgnehpvlvkitldegqpayapgl
ytvhlssfkvgqfgslmidrlrlvpak

Timeline for d1yhaa_:

• d1yhaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1yhaa_ appears in SCOPe 2.06
  
• d1yhaa_ appears in the current release, SCOPe 2.08