Lineage for d4myba_ (4myb A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899284Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2899285Protein automated matches [190951] (34 species)
    not a true protein
  7. 2899345Species Francisella tularensis [TaxId:263] [256365] (1 PDB entry)
  8. 2899346Domain d4myba_: 4myb A: [253834]
    automated match to d1h3mb_

Details for d4myba_

PDB Entry: 4myb (more details), 2.4 Å

PDB Description: Crystal Structure of Francisella tularensis 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (IspD)
PDB Compounds: (A:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d4myba_:

Sequence, based on SEQRES records: (download)

>d4myba_ c.68.1.0 (A:) automated matches {Francisella tularensis [TaxId: 263]}
snkyviipaagigtrmqldipkqyyklnngktildntlvkfidnplfdkifvaiaasdnf
wnnslyynhdkivvcnggetrfnsvynalnviderknddwvfvhdaarpcvsidsiidly
eqtksshsqagilavrayetvkqvtknivvktlardniwlaqtpqlsrlgqlekafdfcy
snnlvakvtdeasalemfginpivvecskknikittkddleyanwql

Sequence, based on observed residues (ATOM records): (download)

>d4myba_ c.68.1.0 (A:) automated matches {Francisella tularensis [TaxId: 263]}
snkyviipaagigdipkqyyklnngktildntlvkfidnplfdkifvaifwnnslyynhd
kivvcnggetrfnsvynalnviderknddwvfvhdaarpcvsidsiidlyeqtksshsqa
gilavrayetvkqvtknivvktlardniwlaqtpqlsrlgqlekafdfcysnnlvakvtd
easalemfginpivvecskknikittkddleyanwql

SCOPe Domain Coordinates for d4myba_:

Click to download the PDB-style file with coordinates for d4myba_.
(The format of our PDB-style files is described here.)

Timeline for d4myba_: