Lineage for d4myaa1 (4mya A:1-485)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2080705Species Bacillus anthracis [TaxId:198094] [228249] (8 PDB entries)
  8. 2080706Domain d4myaa1: 4mya A:1-485 [253832]
    Other proteins in same PDB: d4myaa2, d4myab2
    automated match to d4my1a_
    complexed with 2ey, gol, imp

Details for d4myaa1

PDB Entry: 4mya (more details), 1.9 Å

PDB Description: crystal structure of the inosine 5'-monophosphate dehydrogenase with an internal deletion of the cbs domain from bacillus anthracis str. ames complexed with inhibitor a110
PDB Compounds: (A:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d4myaa1:

Sequence, based on SEQRES records: (download)

>d4myaa1 c.1.5.0 (A:1-485) automated matches {Bacillus anthracis [TaxId: 198094]}
mweskfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadma
iamarqgglgiihknmsieqqaeqvdkvkrsggllvgaavgvtadamtridalvkasvda
ivldtahghsqgvidkvkevrakypslniiagnvataeatkalieaganvvkvgigpgsi
cttrvvagvgvpqltavydcatearkhgipviadggikysgdmvkalaagahvvmlgsmf
agvaespgeteiyqgrqfkvyrgmgsvgamekgskdryfqegnkklvpegiegrvpykgp
ladtvhqlvgglragmgycgaqdleflrenaqfirmsgaglleshphhvqitkeapny

Sequence, based on observed residues (ATOM records): (download)

>d4myaa1 c.1.5.0 (A:1-485) automated matches {Bacillus anthracis [TaxId: 198094]}
mweskfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadma
iamarqgglgiihknmsieqqaeqvdkvkrsggllvgaavgvtadamtridalvkasvda
ivldtahghsqgvidkvkevrakypslniiagnvataeatkalieaganvvkvgigpgsi
cttrvvagvgvpqltavydcatearkhgipviadggikysgdmvkalaagahvvmlgsmf
agvaespgeteiyqgrqfkvyrgmgsvgamekkklvpegiegrvpykgpladtvhqlvgg
lragmgycgaqdleflrenaqfirmsgaglleshphhvqitkeapny

SCOPe Domain Coordinates for d4myaa1:

Click to download the PDB-style file with coordinates for d4myaa1.
(The format of our PDB-style files is described here.)

Timeline for d4myaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4myaa2