![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein automated matches [190064] (21 species) not a true protein |
![]() | Species Obelia longissima [TaxId:32570] [237068] (4 PDB entries) |
![]() | Domain d4mrxa_: 4mrx A: [253831] automated match to d4mrya_ complexed with czh; mutant |
PDB Entry: 4mrx (more details), 1.72 Å
SCOPe Domain Sequences for d4mrxa_:
Sequence, based on SEQRES records: (download)
>d4mrxa_ a.39.1.5 (A:) automated matches {Obelia longissima [TaxId: 32570]} avklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhq vcveaffrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfdifdkd gsgtitldewkafgkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpe adglygngvp
>d4mrxa_ a.39.1.5 (A:) automated matches {Obelia longissima [TaxId: 32570]} avklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhq vcveaffrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfdifddg sgtitldewkafgkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpea dglygngvp
Timeline for d4mrxa_: