Lineage for d4mrqa4 (4mrq A:368-463)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975429Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 2975468Family d.129.2.0: automated matches [254315] (1 protein)
    not a true family
  6. 2975469Protein automated matches [254722] (4 species)
    not a true protein
  7. 2975501Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [256305] (2 PDB entries)
  8. 2975502Domain d4mrqa4: 4mrq A:368-463 [253830]
    Other proteins in same PDB: d4mrqa1, d4mrqa2, d4mrqa3
    automated match to d1p5dx4
    complexed with edo, peg, pge, tla, zn

Details for d4mrqa4

PDB Entry: 4mrq (more details), 1.9 Å

PDB Description: Crystal Structure of wild-type unphosphorylated PMM/PGM
PDB Compounds: (A:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d4mrqa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mrqa4 d.129.2.0 (A:368-463) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
psdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttp
vlvlrfeadteeeleriktvfrnqlkavdsslpvpf

SCOPe Domain Coordinates for d4mrqa4:

Click to download the PDB-style file with coordinates for d4mrqa4.
(The format of our PDB-style files is described here.)

Timeline for d4mrqa4: