Lineage for d1yhba_ (1yhb A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2060311Family b.40.4.7: Phage ssDNA-binding proteins [50315] (4 proteins)
    barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms
  6. 2060317Protein Gene V protein [50316] (2 species)
  7. 2060318Species Enterobacteria phage M13, including coliphage f1 [TaxId:10870] [50317] (19 PDB entries)
  8. 2060333Domain d1yhba_: 1yhb A: [25383]
    protein/DNA complex; mutant

Details for d1yhba_

PDB Entry: 1yhb (more details), 2.2 Å

PDB Description: crystal structures of y41h and y41f mutants of gene v protein from ff phage suggest possible protein-protein interactions in gvp-ssdna complex
PDB Compounds: (A:) gene v protein

SCOPe Domain Sequences for d1yhba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhba_ b.40.4.7 (A:) Gene V protein {Enterobacteria phage M13, including coliphage f1 [TaxId: 10870]}
mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgnefpvlvkitldegqpayapgl
ytvhlssfkvgqfgslmidrlrlvpak

SCOPe Domain Coordinates for d1yhba_:

Click to download the PDB-style file with coordinates for d1yhba_.
(The format of our PDB-style files is described here.)

Timeline for d1yhba_: