Lineage for d4mrqa1 (4mrq A:9-154)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2517507Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2517508Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2517600Family c.84.1.0: automated matches [254314] (1 protein)
    not a true family
  6. 2517601Protein automated matches [254721] (4 species)
    not a true protein
  7. 2517695Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [256304] (2 PDB entries)
  8. 2517696Domain d4mrqa1: 4mrq A:9-154 [253827]
    Other proteins in same PDB: d4mrqa4
    automated match to d1k2yx1
    complexed with edo, peg, pge, tla, zn

Details for d4mrqa1

PDB Entry: 4mrq (more details), 1.9 Å

PDB Description: Crystal Structure of wild-type unphosphorylated PMM/PGM
PDB Compounds: (A:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d4mrqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mrqa1 c.84.1.0 (A:9-154) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
lpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelvkql
iqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvagetlan
eqiqalreriekndlasgvgsveqvd

SCOPe Domain Coordinates for d4mrqa1:

Click to download the PDB-style file with coordinates for d4mrqa1.
(The format of our PDB-style files is described here.)

Timeline for d4mrqa1: