SCOPe 2.06: Domain d4mrqa1: 4mrq A:9-154

Lineage for d4mrqa1 (4mrq A:9-154)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
   consists of three similar domains with 3 layers (a/b/a) each; duplication
   core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest

4. Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families)

5. Family c.84.1.0: automated matches [254314] (1 protein)
   not a true family

6. Protein automated matches [254721] (3 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [256304] (2 PDB entries)

8. Domain d4mrqa1: 4mrq A:9-154 [253827]
   Other proteins in same PDB: d4mrqa4
   automated match to d1k2yx1
   complexed with edo, peg, pge, tla, zn

Details for d4mrqa1

PDB Entry: 4mrq, 1.9 Å

PDB Description: Crystal Structure of wild-type unphosphorylated PMM/PGM

PDB Compounds: (A:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d4mrqa1:

Sequence; same for both SEQRES and ATOM records:

>d4mrqa1 c.84.1.0 (A:9-154) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
lpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelvkql
iqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvagetlan
eqiqalreriekndlasgvgsveqvd

Timeline for d4mrqa1:

• d4mrqa1 first appeared in SCOPe 2.04
  
• d4mrqa1 appears in SCOPe 2.05
  
• d4mrqa1 appears in SCOPe 2.07
  
• d4mrqa1 appears in the current release, SCOPe 2.08