| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) ![]() |
| Family c.84.1.0: automated matches [254314] (1 protein) not a true family |
| Protein automated matches [254721] (2 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:208964] [256304] (2 PDB entries) |
| Domain d4mrqa1: 4mrq A:9-154 [253827] Other proteins in same PDB: d4mrqa4 automated match to d1k2yx1 complexed with edo, peg, pge, tla, zn |
PDB Entry: 4mrq (more details), 1.9 Å
SCOPe Domain Sequences for d4mrqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mrqa1 c.84.1.0 (A:9-154) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
lpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelvkql
iqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvagetlan
eqiqalreriekndlasgvgsveqvd
Timeline for d4mrqa1: