Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) automatically mapped to Pfam PF10436 |
Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins) |
Protein automated matches [230549] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [230552] (22 PDB entries) |
Domain d4mpea1: 4mpe A:12-177 [253823] Other proteins in same PDB: d4mpea2 automated match to d2bu8a1 complexed with pv8, tla |
PDB Entry: 4mpe (more details), 1.95 Å
SCOPe Domain Sequences for d4mpea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mpea1 a.29.5.1 (A:12-177) automated matches {Human (Homo sapiens) [TaxId: 9606]} slagapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinll pdrvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptma qgvleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd
Timeline for d4mpea1: