Lineage for d4mp7a1 (4mp7 A:12-177)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2321920Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 2321921Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins)
  6. 2321940Protein automated matches [230549] (2 species)
    not a true protein
  7. 2321941Species Human (Homo sapiens) [TaxId:9606] [230552] (22 PDB entries)
  8. 2321947Domain d4mp7a1: 4mp7 A:12-177 [253819]
    Other proteins in same PDB: d4mp7a2
    automated match to d2bu8a1
    complexed with pft, tla

Details for d4mp7a1

PDB Entry: 4mp7 (more details), 1.8 Å

PDB Description: Crystal structure of pyruvate dehydrogenase kinase isoform 2 in complex with inhibitor PA7
PDB Compounds: (A:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d4mp7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mp7a1 a.29.5.1 (A:12-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slagapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinll
pdrvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptma
qgvleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

SCOPe Domain Coordinates for d4mp7a1:

Click to download the PDB-style file with coordinates for d4mp7a1.
(The format of our PDB-style files is described here.)

Timeline for d4mp7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mp7a2