SCOPe 2.04: Domain d4mp7a1: 4mp7 A:12-177

Lineage for d4mp7a1 (4mp7 A:12-177)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families)
   automatically mapped to Pfam PF10436

5. Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins)

6. Protein automated matches [230549] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [230552] (13 PDB entries)

8. Domain d4mp7a1: 4mp7 A:12-177 [253819]
   Other proteins in same PDB: d4mp7a2
   automated match to d2bu8a1
   complexed with pft, tla

Details for d4mp7a1

PDB Entry: 4mp7, 1.8 Å

PDB Description: Crystal structure of pyruvate dehydrogenase kinase isoform 2 in complex with inhibitor PA7

PDB Compounds: (A:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d4mp7a1:

Sequence; same for both SEQRES and ATOM records:

>d4mp7a1 a.29.5.1 (A:12-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slagapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinll
pdrvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptma
qgvleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

Timeline for d4mp7a1:

• d4mp7a1 is new in SCOPe 2.04-stable
  
• d4mp7a1 appears in SCOPe 2.05
  
• d4mp7a1 appears in the current release, SCOPe 2.08