Lineage for d4mngf1 (4mng F:2-119)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2357394Domain d4mngf1: 4mng F:2-119 [253815]
    Other proteins in same PDB: d4mnga1, d4mnga2, d4mnga3, d4mngb_, d4mngc1, d4mngc2, d4mngc3, d4mngd_
    automated match to d4mayc1
    complexed with cis, nag

Details for d4mngf1

PDB Entry: 4mng (more details), 3.01 Å

PDB Description: structure of the dp10.7 tcr with cd1d-sulfatide
PDB Compounds: (F:) TRA@ protein,TRA@ protein, Ti antigen CD3-associated protein gamma chain V-J-C region

SCOPe Domain Sequences for d4mngf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mngf1 b.1.1.0 (F:2-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkvtqaqssvsmpvrkavtlnclyetswwsyyifwykqlpskemiflirqgsdeqnaksg
rysvnfkkaaksvaltisalqledsakyfcalgepsywgfprttrvifgkgtrvtvep

SCOPe Domain Coordinates for d4mngf1:

Click to download the PDB-style file with coordinates for d4mngf1.
(The format of our PDB-style files is described here.)

Timeline for d4mngf1: