Lineage for d4mnge2 (4mng E:147-256)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757478Domain d4mnge2: 4mng E:147-256 [253814]
    Other proteins in same PDB: d4mnga1, d4mnga2, d4mnga3, d4mngb_, d4mngc1, d4mngc2, d4mngc3, d4mngd_
    automated match to d4mayc1
    complexed with cis, nag

Details for d4mnge2

PDB Entry: 4mng (more details), 3.01 Å

PDB Description: structure of the dp10.7 tcr with cd1d-sulfatide
PDB Compounds: (E:) TRA@ protein,TRA@ protein, Ti antigen CD3-associated protein gamma chain V-J-C region

SCOPe Domain Sequences for d4mnge2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mnge2 b.1.1.0 (E:147-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tksvirqtgssaeitcdlaegstgyihwylhqegkapqrllyydsytssvvlesgispgk
ydtygstrknlrmilrnliendsgvyycatwdekyykklfgsgtkliitd

SCOPe Domain Coordinates for d4mnge2:

Click to download the PDB-style file with coordinates for d4mnge2.
(The format of our PDB-style files is described here.)

Timeline for d4mnge2: