Lineage for d4mnge1 (4mng E:2-119)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1766234Domain d4mnge1: 4mng E:2-119 [253813]
    Other proteins in same PDB: d4mnga1, d4mnga2, d4mngb_, d4mngc1, d4mngc2, d4mngd_
    automated match to d4mayc1
    complexed with cis, nag

Details for d4mnge1

PDB Entry: 4mng (more details), 3.01 Å

PDB Description: structure of the dp10.7 tcr with cd1d-sulfatide
PDB Compounds: (E:) TRA@ protein, Ti antigen CD3-associated protein gamma chain V-J-C region

SCOPe Domain Sequences for d4mnge1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mnge1 b.1.1.0 (E:2-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkvtqaqssvsmpvrkavtlnclyetswwsyyifwykqlpskemiflirqgsdeqnaksg
rysvnfkkaaksvaltisalqledsakyfcalgepsywgfprttrvifgkgtrvtvep

SCOPe Domain Coordinates for d4mnge1:

Click to download the PDB-style file with coordinates for d4mnge1.
(The format of our PDB-style files is described here.)

Timeline for d4mnge1: