SCOPe 2.04: Domain d4mngc2: 4mng C:184-278

Lineage for d4mngc2 (4mng C:184-278)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (9 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
Domain d4mngc2: 4mng C:184-278 [253811]
Other proteins in same PDB: d4mnga1, d4mngb_, d4mngc1, d4mngd_, d4mnge1, d4mnge2, d4mngf1, d4mngf2
automated match to d3hujc2
complexed with cis, nag

Details for d4mngc2

PDB Entry: 4mng (more details), 3.01 Å

PDB Description: structure of the dp10.7 tcr with cd1d-sulfatide

PDB Compounds: (C:) Antigen-presenting glycoprotein CD1d, Cd1d1 protein

SCOPe Domain Sequences for d4mngc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mngc2 b.1.1.2 (C:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyws

SCOPe Domain Coordinates for d4mngc2:

Click to download the PDB-style file with coordinates for d4mngc2.
(The format of our PDB-style files is described here.)

Timeline for d4mngc2: