Lineage for d4mngc2 (4mng C:184-277)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752969Domain d4mngc2: 4mng C:184-277 [253811]
    Other proteins in same PDB: d4mnga1, d4mnga3, d4mngb_, d4mngc1, d4mngc3, d4mngd_, d4mnge1, d4mnge2, d4mngf1, d4mngf2
    automated match to d3hujc2
    complexed with cis, nag

Details for d4mngc2

PDB Entry: 4mng (more details), 3.01 Å

PDB Description: structure of the dp10.7 tcr with cd1d-sulfatide
PDB Compounds: (C:) Cd1d1 protein

SCOPe Domain Sequences for d4mngc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mngc2 b.1.1.2 (C:184-277) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d4mngc2:

Click to download the PDB-style file with coordinates for d4mngc2.
(The format of our PDB-style files is described here.)

Timeline for d4mngc2: