Lineage for d1ae3a_ (1ae3 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383674Family b.40.4.7: Phage ssDNA-binding proteins [50315] (4 protein domains)
    barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms
  6. 2383680Protein Gene V protein [50316] (2 species)
  7. 2383681Species Enterobacteria phage M13, including coliphage f1 [TaxId:10870] [50317] (19 PDB entries)
  8. 2383694Domain d1ae3a_: 1ae3 A: [25381]
    mutant

Details for d1ae3a_

PDB Entry: 1ae3 (more details), 2 Å

PDB Description: mutant r82c of gene v protein (single-stranded dna binding protein)
PDB Compounds: (A:) gene v protein

SCOPe Domain Sequences for d1ae3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ae3a_ b.40.4.7 (A:) Gene V protein {Enterobacteria phage M13, including coliphage f1 [TaxId: 10870]}
mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgneypvlvkitldegqpayapgl
ytvhlssfkvgqfgslmidrlclvpa

SCOPe Domain Coordinates for d1ae3a_:

Click to download the PDB-style file with coordinates for d1ae3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ae3a_: