Lineage for d4mnga1 (4mng A:6-183)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938555Protein automated matches [191280] (6 species)
    not a true protein
  7. 2938627Species Mouse (Mus musculus) [TaxId:10090] [225821] (8 PDB entries)
  8. 2938631Domain d4mnga1: 4mng A:6-183 [253807]
    Other proteins in same PDB: d4mnga2, d4mnga3, d4mngb_, d4mngc2, d4mngc3, d4mngd_, d4mnge1, d4mnge2, d4mngf1, d4mngf2
    automated match to d3hujc1
    complexed with cis, nag

Details for d4mnga1

PDB Entry: 4mng (more details), 3.01 Å

PDB Description: structure of the dp10.7 tcr with cd1d-sulfatide
PDB Compounds: (A:) Cd1d1 protein

SCOPe Domain Sequences for d4mnga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mnga1 d.19.1.1 (A:6-183) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwet
lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdils
fqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

SCOPe Domain Coordinates for d4mnga1:

Click to download the PDB-style file with coordinates for d4mnga1.
(The format of our PDB-style files is described here.)

Timeline for d4mnga1: