Lineage for d4mlva2 (4mlv A:219-309)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904269Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1904457Superfamily d.50.2: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54782] (2 families) (S)
    automatically mapped to Pfam PF03900
  5. 1904466Family d.50.2.0: automated matches [227289] (1 protein)
    not a true family
  6. 1904467Protein automated matches [227108] (2 species)
    not a true protein
  7. 1904468Species Bacillus megaterium [TaxId:1404] [238215] (2 PDB entries)
  8. 1904469Domain d4mlva2: 4mlv A:219-309 [253805]
    Other proteins in same PDB: d4mlva1
    automated match to d4mlqa2
    complexed with 29p, acy, dpm

Details for d4mlva2

PDB Entry: 4mlv (more details), 1.46 Å

PDB Description: Crystal Structure of Bacillus megaterium porphobilinogen deaminase
PDB Compounds: (A:) porphobilinogen deaminase

SCOPe Domain Sequences for d4mlva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mlva2 d.50.2.0 (A:219-309) automated matches {Bacillus megaterium [TaxId: 1404]}
nhdetaravraervflkemeggcqvpiagygrildggnieltslvaspdgktiykehitg
kdpiaigseaaerltsqgakllidrvkeeld

SCOPe Domain Coordinates for d4mlva2:

Click to download the PDB-style file with coordinates for d4mlva2.
(The format of our PDB-style files is described here.)

Timeline for d4mlva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mlva1