Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.2: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54782] (2 families) automatically mapped to Pfam PF03900 |
Family d.50.2.0: automated matches [227289] (1 protein) not a true family |
Protein automated matches [227108] (3 species) not a true protein |
Species Bacillus megaterium [TaxId:1404] [238215] (5 PDB entries) |
Domain d4mlva2: 4mlv A:219-309 [253805] Other proteins in same PDB: d4mlva1, d4mlva3 automated match to d4mlqa2 complexed with 29p, acy, dpm |
PDB Entry: 4mlv (more details), 1.46 Å
SCOPe Domain Sequences for d4mlva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mlva2 d.50.2.0 (A:219-309) automated matches {Bacillus megaterium [TaxId: 1404]} nhdetaravraervflkemeggcqvpiagygrildggnieltslvaspdgktiykehitg kdpiaigseaaerltsqgakllidrvkeeld
Timeline for d4mlva2: